PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020983.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 192aa    MW: 21214.8 Da    PI: 10.2497
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020983.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.57.7e-15125185161
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                 +ke +r +r+ +NR++A+  R+RKka++ eLe +vk Le+ N++L ++l++l++e + l++
  Do020983.1 125 DKEHRRLKRLLRNRVSAQQARERKKAYLSELEVRVKDLEKRNSELEERLSTLQNENQMLRK 185
                 58899***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-14125189IPR004827Basic-leucine zipper domain
PfamPF001702.3E-13126185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.679127190IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-16129187No hitNo description
SuperFamilySSF579591.06E-12129187No hitNo description
PROSITE patternPS000360132147IPR004827Basic-leucine zipper domain
CDDcd147041.06E-12139181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MQQDQTTSSL PSSSERSSSS APQTEDAREG TPLTNPLFLI LLLYLCHACM RERLTLKWSP  60
AAGAGMESDE EIRRVPEVGL ELMAGPSTSG RETTAGGTAA ASAGTSSSAA QAASAARRRG  120
RSPADKEHRR LKRLLRNRVS AQQARERKKA YLSELEVRVK DLEKRNSELE ERLSTLQNEN  180
QMLRKVLRHV DQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A6e-15150189342Transcription factor HY5
2oqq_B6e-15150189342Transcription factor HY5
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3756942e-61AK375694.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3101I12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453510.13e-55hypothetical protein SORBIDRAFT_04g007060
SwissprotO246469e-49HY5_ARATH; Transcription factor HY5
TrEMBLC5XXX14e-55C5XXX1_SORBI; Putative uncharacterized protein Sb04g007060
STRINGSb04g007060.11e-54(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.16e-38bZIP family protein